People
Harris Wang (Principal Investigator)
Chair of the Department of Systems Biology
Professor of Systems Biology, of Pathology and Cell Biology, and of Biomedical Engineering
Office: Room 203BB, Mary Lasker Biomedical Research Building
Email: harris.wang@columbia.edu
Office: 1-212-305-1697
CV | PubMed | Google Scholar | Twitter
Harris Wang is the Chair of the Department of Systems Biology and a joint Professor in the Department of Pathology and Cell Biology at Columbia University Irving Medical Center and the Department of Biomedical Engineering at Columbia Fu Foundation School of Engineering and Applied Sciences. He holds degrees from MIT (double B.S. in Physics & Math) and Harvard (Ph.D. in Biophysics & Medical Engineering Medical Physics). Dr. Wang's numerous accolades include Vilcek Prize, Blavatnik National Awards, AIMBE Fellow, PECASE, Schaefer Scholar, BWF PATH Investigator, ONR Young Investigator, Sloan Research Fellowship, NSF CAREER, NIH Early Independence Award. Dr. Wang is also an Investigator at the Bi[o]hub and a Fellow at the Institute.
Kristin Beiswenger
Executive Director, Scientific Operations
kmb2237@cumc.columbia.edu
Kristin serves as the Scientific Program Director of DARPA PREPARE and DARPA Arcadia and works on the technology transition and commercialization of various lab inventions. She received her MS in Chemistry from Penn State and her MHA from Columbia University. When she’s not writing technical or financial reports, you can find her cooking for a dinner party, rock climbing, or at a hot yoga class.
Favorite meal: Roberto soup
Favorite yoga pose: Dead bug
Tiffany Seto, PhD
Staff Scientist
ts2992@cumc.columbia.edu
Tiffany is a Staff Scientist and Lab Manager for the lab. She received her PhD in Biomedical Sciences from New York University. When she’s not managing over a million dollars in lab supplies spending per year, you can find her at home watching Bluey with her two daughters, listening to "Let It Go" on repeat, all while pretending to be a playground structure on which they can climb and jump.
Favorite TV shows: Star Wars: The Clone Wars & Fresh Prince of Bel-Air
Favorite book: Tao Te Ching
Nickle Fisher
Administrative Assistant
nf2575@cumc.columbia.edu
Nickle is the Administrative Assistant for the lab. She was previously an Administrative Assistant for Chanel. When she’s not wrangling Harris' crazy calendar, you can find her spending time with her kids and listening to music.
Favorite book: The Power of Now
Favorite band: Coldplay
Yuanyuan Huang, PhD
Associate Research Scientist
yh3727@cumc.columbia.edu
Yuanyuan is an Associate Research Scientist in the lab focusing on engineering functional living fungal-bacterial materials. She received her PhD in fermentation engineering from South China University of Technology. When she’s not engineering living cells, you can find her playing badminton or practicing yoga.
Favorite drink: Coffee
Favorite sport: Badminton
Chao Chen, PhD
Postdoctoral Research Scientist
cc4865@cumc.columbia.edu
Chao is a Postdoc in the lab working on biological tools to study cell physiology and engineer cells with new functions. He received his PhD from Peking University in Chemical Biology. When he’s not playing with cells in the lab, you can find him trying to learn cooking in his kitchen.
Favorite computer game: FIFA
Favorite singer: Jay Chou
Liyuan Lin, PhD
Postdoctoral Research Scientist
ll3778@cumc.columbia.edu
Liyuan is a Postdoc in the lab working on spatial metagenomics of the gut microbiome. She received her PhD in Microbiology and Chemical Biology from Shanghai Jiao Tong University. When she’s not experimenting with bacteria and mice, you can find her exploring the online world.
Favorite restaurant: Szechuan Garden
Favorite star: Zi Yang
Taehee Han, PhD
Postdoctoral Research Scientist
th3138@cumc.columbia.edu
Taehee is a Postdoc in the lab working on enhancing immune cell function and developing biological tools to study cell metabolism. She received her PhD in Chemical and Biomolecular engineering from KAIST. When she’s not playing with cells in the lab, you can find her having a picnic in Central Park.
Favorite actor: Chris Hemsworth
Favorite food: Ma La Xiang Guo
Baiyang Liu, PhD
Postdoctoral Research Scientist
bl3120@cumc.columbia.edu
Baiyang is a Postdoc in the lab working on engineering cyanobacteria as space food. He received his PhD in Systems, Synthetic and Physical Biology from Rice University. When he’s not in the lab engineering bacteria or writing codes, you can find him playing badminton, guitar, and video games.
Favorite composer: Claude Debussy
Favorite Sci-Fi movie: 2001: A Space Odyssey
Yiwei Sun
Postdoctoral Research Scientist
ys3235@cumc.columbia.edu
Yiwei is a Postdoc in the lab. She received her BS in Microbiology, Immunology, and Molecular Genetics from UCLA and completed her PhD in Biomedical Informatics at Columbia. When she’s not analyzing her sequencing data, you can find her adventuring with her cats.
Favorite boba place: KOI
Favorite city to visit: Amsterdam
Charlotte Rochereau
Graduate Student (jointly advised w/ Mohammed AlQuraishi)
cr3007@columbia.edu
Charlotte is a PhD Student in the Integrated Program in Cellular, Molecular, and Biomedical Studies Program. She received her MS in Bioengineering and Systems Biology from AgroParisTech and her MA in Management from HEC Paris. When she’s not training models, you can find on her quest for the best French food suppliers in NYC.
Favorite protein: DYKDDDDVDMGQPGNGSAFLLAPNGSHAPDH…
Favorite jazz club: Smalls
Harry Lee
Graduate Student (jointly advised w/ Mohammed AlQuraishi)
hhl2114@cumc.columbia.edu
Harry is a PhD Student in the Integrated Program in Cellular, Molecular, and Biomedical Studies Program. He received his BS and MS in Computer Science from Columbia University. When he’s not wrangling dataframes on his Jupyter notebook, you’ll likely find him catching a live music set around the city.
Favorite ramen spot in NYC: Menkoi Sato
Favorite podcast: Dwarkesh Podcast
Yiming Qu
Graduate Student
yq2355@cumc.columbia.edu
Yiming is a PhD Student in the Integrated Program in Cellular, Molecular, and Biomedical Studies Program. He received his BS in Biological Science from Tsinghua University. When he is not coding or fiddling clumsily with lab equipment, you might find him browsing Twitter aimlessly or playing badminton aggressively.
Favorite music genre: Chinoiserie
Favorite movie: The Hobbit
Teagan Stedman
Graduate Student
ts3556@cumc.columbia.edu
Teagan is a PhD Student in the Nutritional & Metabolic Biology Program. He received his BS in Bioengineering from Harvard College. When he's not in the tissue culture hood, you can find him chemotaxising to the Central Park dirt loop to run.
Favorite reality show: His cats
Favorite band: Periphery
Sadhya Garg
Graduate Student
sg4333@columbia.edu
Sadhya is a PhD student in the Biomedical Engineering Program. She received her BS in Physics from Tufts University and her MS in Biomedical Engineering from Columbia University. When she’s not engineering cells in lab, you can find her at home tending to her many plants or traipsing across the boroughs in search of good food.
Favorite Park: Riverside
Favorite NYC Museum: The Cloisters
Matthew Nemeth
Graduate Student (jointly advised w/ Mohammed AlQuraishi)
mn3243@cumc.columbia.edu
Matthew is a PhD Student in the Cellular, Molecular and Biomedical Studies Program. He received dual degrees in Electrical Engineering and Computer Sciences and Bioengineering from UC Berkeley. When he’s not evolving proteins and cells, you’ll find him taking a walk with his girlfriend or playing basketball.
Favorite NBA team: 76ers
Favorite food: 小籠包
Shawn Yang
Graduate Student
shy2124@cumc.columbia.edu
Shawn is a PhD student in the Integrated Program in Cellular, Molecular, and Biomedical Studies. He received his BA in Biological Sciences from the University of Southern California. When he’s not in the lab, you can find him at the gym or exploring the city.
Favorite TV show: South Park
Favorite NYC Bar: Tiki Chick
Olivia Teng
Research Technician
ot2231@cumc.columbia.edu
Olivia is a research technician in the Wang Lab. She received her BA in Biophysics from Barnard College of Columbia University. When she is not running Foli-seq experiments, you can find her trying new cafes or taking ballet classes throughout the city.
Favorite matcha spot: Matcha 108
Favorite ballet dancer: Merritt Moore
Laura Cheunkarndee
Undergraduate Student
lpc2137@barnard.edu
Laura is an undergraduate prospective Biochemistry major at Barnard College. When she’s not transforming cells, you can find her trying every boba and matcha place in New York or dancing on Columbia’s Dance Team.
Favorite book: Crying in H-Mart
Favorite dessert: Chocolate-covered strawberries
Davud Skenderi
Undergraduate Student
dbs2192@columbia.edu
Davud is an undergraduate Biomedical Engineering major and Applied Mathematics minor at Columbia Engineering. When he's not heedlessly in his dorm reading, you can find him creating haphazard playlists or mixing bits of random languages into an abhorrent mess.
Favorite book: Babel, R.F Kuang
Favorite music genre: Mandarin R&B
Anna Baghdassarian
Undergraduate Student
ab5959@barnard.edu
Anna is an undergraduate Cellular and Molecular Biology major at Barnard College. When she’s not running PCR, you can find her attempting to cook Armenian food in her ill-equipped kitchen.
Favorite movie: The Princess Bride
Favorite color: Yellow
Theodore Wang
Junior Volunteer
Theo is an understudy in the lab. His aspirations include mastering debate, mathematics, cello, and airbending.
Elizabeth Wang
Junior Volunteer
Elizabeth is an understudy in the lab. She enjoys feeding and playing with her bunny Rayray and learning to ride her bike.
GeeMo (RIP) and friends
Lab mascots
Geemo and his friends are our resident axolotls. They regularly enjoy biting and swallow their tankmates and showing off their regenerative superpowers.
